PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna07416.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 309aa    MW: 34899.8 Da    PI: 6.832
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna07416.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+ Ed  l ++++ +G g W+  +++ g++R++k+c++rw++yl
  mrna07416.1-v1.0-hybrid 14 RGAWTAMEDRTLTEYITTHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 61
                             89********************************************97 PP

2Myb_DNA-binding51.62.2e-1667110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++
  mrna07416.1-v1.0-hybrid  67 RGNITRDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                              7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.949961IPR017930Myb domain
SuperFamilySSF466892.11E-2712108IPR009057Homeodomain-like
SMARTSM007172.7E-121363IPR001005SANT/Myb domain
PfamPF002492.8E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-231568IPR009057Homeodomain-like
CDDcd001672.02E-91661No hitNo description
PROSITE profilePS5129424.98662116IPR017930Myb domain
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2369116IPR009057Homeodomain-like
CDDcd001675.63E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRSPCCAKE GLNRGAWTAM EDRTLTEYIT THGEGKWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TRDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NIGKKVQDHS  120
STNSEANITH HKPPNHQTQK KNTNVVRTKA SRCTKVFMPH QQSQIDKKGT CNNPTADQQG  180
AAPFLNHDYY DPVNYNDDPA LRMMGITDTH HQESDDFSPL LNLEIDNENS NSCGFMVDFK  240
MDESFLSEFL NVDFSELYSS STSTANGGDG VKAAISTTCG DDDHHEQHGP DFRSSMAPII  300
DSELDWLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9892820.0JQ989282.1 Fragaria x ananassa transcription factor MYB11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303684.10.0PREDICTED: transcription factor TT2-like
SwissprotQ9FJA24e-63TT2_ARATH; Transcription factor TT2
TrEMBLI3WCS30.0I3WCS3_FRAAN; Transcription factor MYB11
STRINGVIT_09s0002g01400.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.17e-64MYB family protein